Protein coding transcript 222625

• Transcript: Ll_transcript_10414
• CDS coordinates: 3-533 (+)
• Peptide sequence: EEEATAADTMVKYSREPDNPTKSCKARGADLRVHFKNTRETAFSIRKLPLVKAKRYLEDVLAHKQAIPFRRFCRGVGRTAQAKNRHSNGQGRWPVKSAKFILDLLKNAESNAEVKGLDIDALYISHIQVNQAQRQRRRTYRAHGRINPYMSSPCHIELTLSEKEEPVKKEPESQLAP
• ORF Type: internal

Annotations of Ll_transcript_10414

• Blastp: 60S ribosomal protein L17-2 from Arabidopsis with 89.22% of identity
• Blastx: 60S ribosomal protein L17-2 from Arabidopsis with 89.22% of identity
• Eggnog: The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome (By similarity)(COG0091)
• Kegg: Link to kegg annotations (AT1G67430)
• CantataDB: Link to cantataDB annotations (CNT0000618)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414713.1)
• Pfam: Ribosomal protein L22p/L17e (PF00237.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;