Protein coding transcript 222648

• Transcript: Ll_transcript_10876
• CDS coordinates: 450-821 (+)
• Peptide sequence: MVFGENTLILKHLTSGTKIHFNAFDALCGWKQEALPPVEVPAATKWKCRTKPSKQVILDYDYTFTTPYCGSGTIEFDKELNGREFSEENRNLHWEECKEQIDVATLASKEPILFYDEVSSRFL*
• ORF Type: complete

Annotations of Ll_transcript_10876

• Blastp: TIP41-like protein from Arabidopsis with 69.75% of identity
• Blastx: TIP41-like protein from Arabidopsis with 69.92% of identity
• Eggnog: TIP41, TOR signaling pathway regulator-like (S. cerevisiae)(ENOG410XT96)
• Kegg: Link to kegg annotations (AT4G34270)
• CantataDB: Link to cantataDB annotations (CNT0001789)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004496911.1)
• Pfam: TIP41-like family (PF04176.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;