Protein coding transcript 222730

• Transcript: Ll_transcript_10631
• CDS coordinates: 425-889 (+)
• Peptide sequence: MDPKDLFSANLLDGGMATCIEGQHTPSVIVIGAGISGIAAARTLYDASFKVTVLESRDRLGGRIHTDYSLGCPVDMGASWLHGVCNENPLAPLIRHLGLTLYRTSGDNSVLYDHDLESYMLFNIDGHQVPQQMVVEVGETFKRILEETGKVRDEH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_10631

• Blastp: Probable polyamine oxidase 4 from Arabidopsis with 69.93% of identity
• Blastx: Probable polyamine oxidase 4 from Arabidopsis with 69.93% of identity
• Eggnog: amine oxidase(ENOG410XSNC)
• Kegg: Link to kegg annotations (AT1G65840)
• CantataDB: Link to cantataDB annotations (CNT0002491)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419803.1)
• Pfam: FAD binding domain (PF00890.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;