Protein coding transcript 222731

• Transcript: Ll_transcript_10635
• CDS coordinates: 655-1074 (+)
• Peptide sequence: MATCIEGQHTPSVIVIGAGISGIAAARTLYDASFKVTVLESRDRLGGRIHTDYSLGCPVDMGASWLHGVCNENPLAPLIRHLGLTLYRTSGDNSVLYDHDLESYMLFNIDGHQVPQQMVVEVGETFKRILEETGKVRDEH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_10635

• Blastp: Probable polyamine oxidase 4 from Arabidopsis with 78.29% of identity
• Blastx: Probable polyamine oxidase 4 from Arabidopsis with 76.99% of identity
• Eggnog: amine oxidase(ENOG410XSNC)
• Kegg: Link to kegg annotations (AT1G65840)
• CantataDB: Link to cantataDB annotations (CNT0002491)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419803.1)
• Pfam: FAD binding domain (PF00890.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;