Transcript | Ll_transcript_10696 |
---|---|
CDS coordinates | 3-632 (+) |
Peptide sequence | KIGPTMDPTVTWDPPSLFLSPKHYIHECFFFSSPFSPFSTSTMAPSSLLSNTFLSPIHLPSSNSSHPKPSFLNFPTNTFRSLTHSKNTTNPTPFTTFCSSDSPKDDSSIPIESRYPAFPTVMDINQIREILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEVVNTMLILHFLLLSFFVFPISYYIYVL* |
ORF Type | 5prime_partial |
Blastp | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ from Janthinobacterium with 56.58% of identity |
---|---|
Blastx | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ from Clostridium with 50% of identity |
Eggnog | Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs (By similarity)(COG0764) |
Kegg | Link to kegg annotations (mma_2047) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426358.1) |
Pfam | FabA-like domain (PF07977.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer