Transcript | Ll_transcript_9137 |
---|---|
CDS coordinates | 91-474 (+) |
Peptide sequence | MGYLQKDKRTGRPKIWLYRDKETNEPKGDATVTYEDPHAALAAVEWFNNKDFHGSTIGVYIAESKNKDDQTFNTVVEPLVSDNVGGVEETPADVNGGSGRGRGRNETSGKAWKQEGDWMCTNTRSVI* |
ORF Type | complete |
Blastp | Transcription initiation factor TFIID subunit 15 from Arabidopsis with 68.29% of identity |
---|---|
Blastx | Transcription initiation factor TFIID subunit 15 from Arabidopsis with 64.15% of identity |
Eggnog | Ewing sarcoma breakpoint region 1(ENOG4111Q2F) |
Kegg | Link to kegg annotations (AT1G50300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460793.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer