Transcript | Ll_transcript_10118 |
---|---|
CDS coordinates | 3-656 (+) |
Peptide sequence | TIPSHIKFCKLHYIKKRRKKNKKKAKMGGKKIPEVLLNSGQKMPVIGMGTSIDPPRPSNAELASIFVDAIEVGYTHFDSASVYGTEEAIGLAVAKALELGLIKSRDEVFITSKPWNTDAHHDLIVPALKTTLKKLGMEYVDLYLIHWPVRLRHDLENPTVFSKEDLLPFDVEGTWKAMEDCYKLGLAKSIGVCNYGIKKLTKLLEIATIPPAVIQVT* |
ORF Type | 5prime_partial |
Blastp | Methylecgonone reductase from Erythroxylum with 57.95% of identity |
---|---|
Blastx | Methylecgonone reductase from Erythroxylum with 58.55% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (ADK94763) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431372.1) |
Pfam | Aldo/keto reductase family (PF00248.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer