Protein coding transcript 223079

• Transcript: Ll_transcript_11554
• CDS coordinates: 219-824 (+)
• Peptide sequence: MRSDGILGTRDAEDRSKWLKRKEIWLVVLGVILHAVYMLSIFDIYFKTPIVHGVDLVTPRFTAPAKRLVLLVADGLRADKFYEPDSEGNYRAPFLRSIIKTQGRWGVSHARPPTESRPGHVAIIAGFYEDPSAVTKGWKANPVEFDSVFNRSQHTISFGSPDIVPIFCGALQHSTWNSYPHEFEDFATGLTLLFQYALFQF*
• ORF Type: complete

Annotations of Ll_transcript_11554

• Blastp: GPI ethanolamine phosphate transferase 1 from Mus with 61.59% of identity
• Blastx: GPI ethanolamine phosphate transferase 1 from Mus with 61.59% of identity
• Eggnog: type i phosphodiesterase nucleotide pyrophosphatase(COG1524)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453347.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;