Transcript | Ll_transcript_318714 |
---|---|
CDS coordinates | 1422-1961 (+) |
Peptide sequence | MKIIHQDPMLQAQRVAAIKKAKGTVAARKHTSKTMKAFFSDPINRLKRSIAMKGVKFYCQHCGREGHRRHYCPEIKGSLIRWQYACRLCGGKGHNRRTCINSRISHTGGSVKKQYRCKICHRYGHNRRACPQVVSNKRRDLASQRTYKCRLCHKEGHNSRTCPSRTVVAEHSQEEQSMN* |
ORF Type | complete |
Blastp | DNA-binding protein HEXBP from Leishmania with 33.96% of identity |
---|---|
Blastx | DNA-binding protein HEXBP from Leishmania with 33.96% of identity |
Eggnog | zinc finger(COG5082) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446859.1) |
Pfam | Zinc knuckle (PF14392.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer