Transcript | Ll_transcript_11552 |
---|---|
CDS coordinates | 249-1100 (+) |
Peptide sequence | MKSCILFLQIYLYGCVVTAMLSLLLLLEHSPPLYHMYMIMTSFSWVQIFSEYQFINSLWKHLSGRKVNILIKLLATTAFSVFILEFLVNSFTERKLYTVCFLIAGVAASIYLLKSIPWKSGIPIYVWIACWFLSVFTLMPAEIPDNNQLVVGSGAVIIIIGIAARWLDLHAGRRKYWLSICNRELKSPRTSPLFYTQVLLVALSSVMVYLSTSHRTEKQELLALHQLVNWSVAGISMVLPLFSENSILSRLTSIFLGFAPPFLLLSIGYNSHALDSSCCSLIS* |
ORF Type | complete |
Blastp | GPI ethanolamine phosphate transferase 1 from Aspergillus with 23.91% of identity |
---|---|
Blastx | GPI ethanolamine phosphate transferase 1 from Aspergillus with 24.6% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AOR_1_540054) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453347.1) |
Pfam | Phosphatidylinositolglycan class N (PIG-N) (PF04987.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer