| Transcript | Ll_transcript_318715 |
|---|---|
| CDS coordinates | 461-949 (+) |
| Peptide sequence | MQKAKGTVAARKHTSKTMKAFFSDPINRLKRSIAMKGVKFYCQHCGREGHRRHYCPEIKGSLIRWQYACRLCGGKGHNRRTCINSRISHTGGSVKKQYRCKICHRYGHNRRACPQVVSNKRRDLASQRTYKCRLCHKEGHNSRTCPSRTVVAEHSQEEQSMN* |
| ORF Type | complete |
| Blastp | DNA-binding protein HEXBP from Leishmania with 33.96% of identity |
|---|---|
| Blastx | DNA-binding protein HEXBP from Leishmania with 33.96% of identity |
| Eggnog | zinc finger(COG5082) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446859.1) |
| Pfam | Zinc knuckle (PF14392.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer