Protein coding transcript 223098

• Transcript: Ll_transcript_11162
• CDS coordinates: 232-1323 (+)
• Peptide sequence: MEKSQIWIKTIAFAAIAFALIFVSAYADDVVVLSEENFEKEIGQDKGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVVIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRTAEALAEYINTEGGTNVKIATAPSNVVVLTAENFNEVVLDETKDVLVEFYAPWCGHCKSLAPTYEKVATAFKFEQDVVIANLDADKYRDLAEKYGVSGFPTLKFFPKNNKAGEEYGGGRDMDDFVAFINEKSGTSRDGKGQLTSKAGIVESLDALVKEFVAAGDEEKKAVFTKIEEEAGKLKGSASRHGKIYVKATKSYLEKGSDYAKNEIQRLQRILEKSISPSKADELTLKKNILSTYA*
• ORF Type: complete

Annotations of Ll_transcript_11162

• Blastp: Probable protein disulfide-isomerase A6 from Medicago with 84.85% of identity
• Blastx: Probable protein disulfide-isomerase A6 from Medicago with 82.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427939.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;