Protein coding transcript 223102

• Transcript: Ll_transcript_11165
• CDS coordinates: 84-521 (+)
• Peptide sequence: MERSQIWNKTLTFGAIAFAFALIFVSASADDVVVLSEDNFEKEVGQDKGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVVIGKVSTLVFYDFIPSNIVYIFFTSVSILFSFEVSFNFQGFLYVYDANGNSTLEQFGVAYLSS*
• ORF Type: complete

Annotations of Ll_transcript_11165

• Blastp: Probable protein disulfide-isomerase A6 from Medicago with 73.86% of identity
• Blastx: Protein disulfide-isomerase like 2-1 from Arabidopsis with 85.19% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453045.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;