Protein coding transcript 223103

• Transcript: Ll_transcript_11167
• CDS coordinates: 84-1181 (+)
• Peptide sequence: MERSQIWNKTLTFGAIAFAFALIFVSASADDVVVLSEDNFEKEVGQDKGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVVIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGPRNAEALAEYVNTEGGTNVKIATAPSNVVVLSAENFNEVVLDETKDVLVEFYAPWCGHCKSLAPIYEKVATAFKLEEDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKNNKAGEEYGGGRDLDDFVAFINEKSGTSRDGNGQLTSKAGIVESLDALVKEFVAAGDEEKKVVSTKIEEEFSKLKGSASRHGKIYLKATKNYLEKGSDYAKKEIQRLQRILDKSISPSKADELTVKKNILSTYA*
• ORF Type: complete

Annotations of Ll_transcript_11167

• Blastp: Probable protein disulfide-isomerase A6 from Medicago with 83.29% of identity
• Blastx: Probable protein disulfide-isomerase A6 from Medicago with 86.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441315.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;