Transcript | Ll_transcript_11171 |
---|---|
CDS coordinates | 84-443 (+) |
Peptide sequence | MERSQIWNKTLTFGAIAFAFALIFVSASADDVVVLSEDNFEKEVGQDKGALVEFYAPWCGHCKKLAPEYEKLGSSFKKAKSVVIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKK* |
ORF Type | complete |
Blastp | Probable protein disulfide-isomerase A6 from Medicago with 80.67% of identity |
---|---|
Blastx | Probable protein disulfide-isomerase A6 from Medicago with 86.21% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441315.1) |
Pfam | Thioredoxin (PF00085.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer