Transcript | Ll_transcript_9796 |
---|---|
CDS coordinates | 783-1916 (+) |
Peptide sequence | MIILTPGFDNANGEWDEYPSYVNSEGLEIRSPGVYNENPSLIFHSGYGFNPQMPYGPYSPITTPLPSVGGDAQLYSQQFPYASPPYYHQLVPPSVSYLNSPTPVSQPELTNLVGIDQQVDSMFFGPRPGYPSVGSFGRGSFPGAPGSLGFHESQQGFDGPRSGGIWSDSSKPSERQRSLVPLSPSVSPQPIGSHCSFGQTVGMASHQQRSPYGFGSSRGYLPDQGSNFGGNAISNFSTNDRSFLSVENSRRQVRATAALCNCNGTLDILSEQNRGPRASKLKNQISSENNYVDNNKSNASIAKFQNESVNRSDFATNYKDAKFFVIKSYSEDNVHKSIKYGVWASTPNGNRKLDATYHQAKEKQDACPIFLFFSVSI* |
ORF Type | complete |
Blastp | YTH domain-containing family protein 2 from Mus with 50% of identity |
---|---|
Blastx | YTH domain-containing family protein 1 from Homo with 53.85% of identity |
Eggnog | YTH domain family(ENOG410YABQ) |
Kegg | Link to kegg annotations (213541) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448458.1) |
Pfam | YT521-B-like domain (PF04146.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer