Protein coding transcript 223131

• Transcript: Ll_transcript_9783
• CDS coordinates: 3807-4334 (+)
• Peptide sequence: MVGPVNFEKSVDFWQQDKWSGQFPVKWHMIKDVPNSQFRHILLENNDNKPVTNSRDTQEVKLQQGIEILTIFKNYETEVSVLDDFDFYEDRQKAMQERKARQQGGGNVMGGVGVVGEGEHRNSSANIIKQMSKSFAQVVRLDETNSEVIVVADRGGGNLASDDGISVVASSTQTS*
• ORF Type: complete

Annotations of Ll_transcript_9783

• Blastp: YTH domain-containing family protein 1 from Mus with 57.61% of identity
• Blastx: YTH domain-containing family protein 1 from Homo with 53.85% of identity
• Eggnog: YTH domain family(ENOG410YABQ)
• Kegg: Link to kegg annotations (228994)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448458.1)
• Pfam: YT521-B-like domain (PF04146.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;