Transcript | Ll_transcript_9225 |
---|---|
CDS coordinates | 1081-1554 (+) |
Peptide sequence | MECAISIGKSVNGVPLWVIEISDKPGEEEAEPAFKYIGNVHGDEPVGRELLIFLANWLCDNHLKDPLATLIVENVHLHILPSMNPDGFSLRRRRNANNIDLNRNFPDQFFPVNDDEDSRQPETRAIMNWLRDIRFTASATLHGVLLISNSRNSSFNL* |
ORF Type | complete |
Blastp | Carboxypeptidase SOL1 from Arabidopsis with 81.25% of identity |
---|---|
Blastx | Carboxypeptidase SOL1 from Arabidopsis with 83.33% of identity |
Eggnog | carboxy-peptidase(ENOG410XX0H) |
Kegg | Link to kegg annotations (AT1G71696) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442044.1) |
Pfam | Zinc carboxypeptidase (PF00246.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer