| Transcript | Ll_transcript_9250 |
|---|---|
| CDS coordinates | 187-498 (+) |
| Peptide sequence | MTNNLFFSLFLLLASTLSSPSLARVPFHTNAPSEDFKNISYATRARHLLEDNESQAQKIVDFARGYMTNDDLETAVKEFGQRCSNISRIYRDSWNVQLVLGRV* |
| ORF Type | complete |
| Blastp | Carboxypeptidase SOL1 from Arabidopsis with 37.21% of identity |
|---|---|
| Blastx | Carboxypeptidase SOL1 from Arabidopsis with 90% of identity |
| Eggnog | carboxy-peptidase(ENOG410XX0H) |
| Kegg | Link to kegg annotations (AT1G71696) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442038.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer