Protein coding transcript 2232

• Transcript: Ll_transcript_427100
• CDS coordinates: 3-329 (+)
• Peptide sequence: QIELTSTCYQSGRLITAIMANIFAPDVSEEKGENARLSSFVGAIAVGDLVKSTLGPKGMDKILQSASTGTVMVTNDGATILKSIALDNAAAKVLVNISKVQDDEVGDGT
• ORF Type: internal

Annotations of Ll_transcript_427100

• Blastp: T-complex protein 1 subunit beta from Saccharomyces with 85.23% of identity
• Blastx: T-complex protein 1 subunit beta from Saccharomyces with 85.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL142W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003626285.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;