Protein coding transcript 223237

• Transcript: Ll_transcript_204020
• CDS coordinates: 1702-2208 (+)
• Peptide sequence: MDLNLLKNFNGTTDLDSNLFGHMAGGASNGIRDLSKLEAGASCTAEVLQALPFLKKAYGDSLRKVLHVGPESCSLVSNLLKEEDTEAWGIEPYELDDVSAKCKNLVHKGVVRVADIKFPLPYRPKSFSLVIVSDALDYLSPKYLNKTLPELVRVSSDGVVVFSGISRV*
• ORF Type: complete

Annotations of Ll_transcript_204020

• Blastp: Uncharacterized protein At3g49720 from Arabidopsis with 67.12% of identity
• Blastx: Uncharacterized protein At3g49720 from Arabidopsis with 67.12% of identity
• Eggnog: NA(ENOG4111QN3)
• Kegg: Link to kegg annotations (AT3G49720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440317.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;