Protein coding transcript 223238

• Transcript: Ll_transcript_204034
• CDS coordinates: 1195-1602 (+)
• Peptide sequence: MSRRPVNPARRFGDGGSIPFVTSIQAKSHNSPLLSIGLVVVGAILLIGYCYSNSGGASNGIRDLSKLEAGASCTAEVLQALPFLKKAYGDSLRKVLHVGPESCSLVSNLLKEEDTEAWGIEPYELDDVSAKCKNLV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_204034

• Blastp: Uncharacterized protein At3g49720 from Arabidopsis with 59.56% of identity
• Blastx: Uncharacterized protein At3g49720 from Arabidopsis with 59.56% of identity
• Eggnog: NA(ENOG4111QN3)
• Kegg: Link to kegg annotations (AT3G49720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440317.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;