| Transcript | Ll_transcript_204028 |
|---|---|
| CDS coordinates | 1195-1554 (+) |
| Peptide sequence | MSRRPVNPARRFGDGGSIPFVTSIQAKSHNSPLLSIGLVVVGAILLIGYCYSNSGGASNGIRDLSKLEGKYFNYKFSICNLKLPRHSPYRTAEACSNDAGVLKYSISYSYFLCIRCLSS* |
| ORF Type | complete |
| Blastp | Uncharacterized protein At3g49720 from Arabidopsis with 54.93% of identity |
|---|---|
| Blastx | Uncharacterized protein At3g49720 from Arabidopsis with 75.81% of identity |
| Eggnog | NA(ENOG4111QN3) |
| Kegg | Link to kegg annotations (AT3G49720) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019440317.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer