Transcript | Ll_transcript_203456 |
---|---|
CDS coordinates | 1500-1817 (+) |
Peptide sequence | MAKTRRLNCLLENEADPNIRDCNGKLPLWEALQHGHTLMRDKLIQYGTIIEQHDKFGFVSFATTQNDNTLMQEILQYHITLPTIASLVEECHEHESDVHMRHNYY* |
ORF Type | complete |
Blastp | Potassium channel AKT1 from Arabidopsis with 40.26% of identity |
---|---|
Blastx | Potassium channel AKT1 from Oryza sativa with 25.75% of identity |
Eggnog | Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE) |
Kegg | Link to kegg annotations (AT2G26650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427311.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer