Transcript | Ll_transcript_318732 |
---|---|
CDS coordinates | 1-519 (+) |
Peptide sequence | EKTKMSGTVKKVSDVAFKAGKAIDWEGMAKLLVSDEARKEFSNLRRAFDEVNSQLQTKFSQEPEPIDWDYYRKGIGNRLVDMYKEHYDSIEVPKFVDNVTPQYKPKFEALLVELKEAEQKSFKESERLEKEIADVQELKKKLSTMTADEYFAKHPELKKKFDDEIRNDYWGY* |
ORF Type | 5prime_partial |
Blastp | ATP synthase subunit d, mitochondrial from Arabidopsis with 83.93% of identity |
---|---|
Blastx | ATP synthase subunit d, mitochondrial from Arabidopsis with 83.93% of identity |
Eggnog | energy coupled proton transport, down electrochemical gradient(ENOG4111IHJ) |
Kegg | Link to kegg annotations (AT3G52300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452721.1) |
Pfam | ATP synthase D chain, mitochondrial (ATP5H) (PF05873.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer