Transcript | Ll_transcript_204069 |
---|---|
CDS coordinates | 1237-1647 (+) |
Peptide sequence | MVLNFIIHCEFFVQETEEMIADVLGVEVFRQTVAGNILVGSYCAFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIAAGMTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSLIDSYV* |
ORF Type | complete |
Blastp | Eukaryotic translation initiation factor 6-2 from Arabidopsis with 89.43% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 6-2 from Arabidopsis with 93.5% of identity |
Eggnog | Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm(COG1976) |
Kegg | Link to kegg annotations (AT3G55620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426674.1) |
Pfam | eIF-6 family (PF01912.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer