Transcript | Ll_transcript_204554 |
---|---|
CDS coordinates | 1068-1472 (+) |
Peptide sequence | MLVHQMLAGNYMSSNSQSFSFKYCLLDNKELIMSTWTGVKQVEVNREESKVTVSGYVDRNKVLKKVQSTGKRAKFWPYIQYNLVPYPYVAQAYDKKAPSGYVRNIVQTLPNPNATDEKITTLFSDDNPNACLIM* |
ORF Type | complete |
Blastp | Heavy metal-associated isoprenylated plant protein 22 from Arabidopsis with 59.22% of identity |
---|---|
Blastx | Heavy metal-associated isoprenylated plant protein 22 from Arabidopsis with 59.22% of identity |
Eggnog | heavy metal transport detoxification protein(COG2608) |
Kegg | Link to kegg annotations (AT1G22990) |
CantataDB | Link to cantataDB annotations (CNT0001191) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439158.1) |
Pfam | Heavy-metal-associated domain (PF00403.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer