Protein coding transcript 223294

• Transcript: Ll_transcript_204541
• CDS coordinates: 505-852 (+)
• Peptide sequence: MDCEGCERRVRSSVSNMKGVKQVEVNREESKVTVSGYVDRNKVLKKVQSTGKRAKFWPYIQYNLVPYPYVAQAYDKKAPSGYVRNIVQTLPNPNATDEKITTLFSDDNPNACLIM*
• ORF Type: complete

Annotations of Ll_transcript_204541

• Blastp: Heavy metal-associated isoprenylated plant protein 22 from Arabidopsis with 59.48% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 22 from Arabidopsis with 60.32% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT1G22990)
• CantataDB: Link to cantataDB annotations (CNT0001191)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439158.1)
• Pfam: Heavy-metal-associated domain (PF00403.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;