Protein coding transcript 2233

• Transcript: Ll_transcript_427126
• CDS coordinates: 148-477 (+)
• Peptide sequence: MGIRLLPEMVHHAKQILRFWSHQSSKQYQFSGQSDSNIFHIPKGHFAVYVGVEDEYKKRFVVPISYLKQPLFQDLLSKAEEEFGFEYRMGNLVIPCPIDHFVNLTSHFN*
• ORF Type: complete

Annotations of Ll_transcript_427126

• Blastp: Auxin-responsive protein SAUR20 from Arabidopsis with 59.21% of identity
• Blastx: Auxin-responsive protein SAUR20 from Arabidopsis with 59.21% of identity
• Eggnog: auxin-responsive protein(ENOG4111DHX)
• Kegg: Link to kegg annotations (AT5G18020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004507057.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;