Protein coding transcript 223320

• Transcript: Ll_transcript_204695
• CDS coordinates: 1066-1731 (+)
• Peptide sequence: MMTKEEFNAKTLSPREWKGPLLKGDTFVTLKNGVGYINKKIVFSDNSSWTRSGMFRLGVKAVQSSFIGVEIREGISEPFRVKDNRGEVYKKHDCPSLNDEVWRLKRIAKDSKIHMKLSSHNINTVKDLLQLFITNQTSLKEIIGNISRKSWDTIIEHAKACDIDDDKLYVYHWFSAEESVSIVFNCIYNVVEVSFNRQSFRSLETLSLDEKVGIYILFYMG*
• ORF Type: complete

Annotations of Ll_transcript_204695

• Blastp: Calmodulin-binding protein 60 B from Arabidopsis with 46.01% of identity
• Blastx: Calmodulin-binding protein 60 G from Arabidopsis with 42.9% of identity
• Eggnog: calmodulin binding protein(ENOG4111EYI)
• Kegg: Link to kegg annotations (AT5G57580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017414073.1)
• Pfam: Calmodulin binding protein-like (PF07887.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;