Protein coding transcript 223344

• Transcript: Ll_transcript_203631
• CDS coordinates: 1049-1492 (+)
• Peptide sequence: MHSGCTFNHRYVKSNPMEVENATWMLTVFHCFGQYFCLHFEAFQIGTAPVYMAFLRFMGDERDARTYGYSLEVGGNGRKLTYEGSPRSIRDSHKKVRDSHDGLIVYRNMALFFSGVDRKELKLRVTGRIWKEQQNPEGGVCIPNLCS*
• ORF Type: complete

Annotations of Ll_transcript_203631

• Blastp: E3 ubiquitin-protein ligase SINAT5 from Arabidopsis with 84.35% of identity
• Blastx: E3 ubiquitin-protein ligase SINAT4 from Arabidopsis with 83.53% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G53360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456873.1)
• Pfam: Seven in absentia protein family (PF03145.15)
• Rfam: 5S_rRNA (RF00001)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;