Protein coding transcript 223346

• Transcript: Ll_transcript_203633
• CDS coordinates: 396-1328 (+)
• Peptide sequence: MDSESVDSSISSLTMIDEDVNPHQFSSINTKIRSNGPIANSVHELLQCPVCTNSMYPPIHQCHNGHTLCSTCKTRVHNRCPTCRLELGDIRCLALEKIAESLELPCRYTSLGCPEIFPYYSKLKHESICNFRPYNCPYAGSDCSVVGDIPYLVTHLRDDHRVDMHSGCTFNHRYVKSNPMEVENATWMLTVFHCFGQYFCLHFEAFQLGTAPVYMAFLRFMGDERDARSYSYSLEVGGNGRKLTYEGSPRSIRDSHKKVRDSHDGLIVYRNMALFFSGSDKKELKLRVTGRIWKEQQNPEGGVCIPNLYS*
• ORF Type: complete

Annotations of Ll_transcript_203633

• Blastp: E3 ubiquitin-protein ligase SINAT3 from Arabidopsis with 74.77% of identity
• Blastx: E3 ubiquitin-protein ligase SINAT3 from Arabidopsis with 85.4% of identity
• Eggnog: e3 ubiquitin-protein ligase(ENOG410XVP0)
• Kegg: Link to kegg annotations (AT3G61790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429063.1)
• Pfam: Seven in absentia protein family (PF03145.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;