Transcript | Ll_transcript_203620 |
---|---|
CDS coordinates | 320-913 (+) |
Peptide sequence | MESGSVDNSLSSLIMMDEAENPHQFSSITTKLHSNGPTATSVHELLECPVCTNSMYPPIHQCHNGHTLCSTCKTRVNNRCPTCRQELGDIRCLALEKIAESLELPCRYNSLGCPEIFPYYSKLKHESICNFRPYNCPYTGSDCSVVGDIPYLVTHLRDDHRVDMHSGCTFNHRYVKSNPMEVENATWMLTVSILFSE* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase SINAT3 from Arabidopsis with 86.34% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase SINAT3 from Arabidopsis with 86.34% of identity |
Eggnog | e3 ubiquitin-protein ligase(ENOG410XVP0) |
Kegg | Link to kegg annotations (AT3G61790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456873.1) |
Pfam | Seven in absentia protein family (PF03145.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer