Transcript | Ll_transcript_204430 |
---|---|
CDS coordinates | 301-1305 (+) |
Peptide sequence | MMKERFAKLLLGEDMSGGGKGVCTALAISNAITNLSATVFGELWRLEPLAAPKKAMWRREMEWLLCVSDSIVELVPAVQQFPGGGTYEVMAMRPRSDLFINLPALKKLDGMLLGMLDGFEDTQFWYVDKGIILGDSKDCDDYNGRPSVRQEEKWWLPSAKVPPNGLSEIDRKRLQQCRDCTNQILKAAMAINSSVLAEMEIPRAYIGSLPKNGKACLGDIIYRYVTADQFSPECLLDCLDLSSEHHTLDVANRIEAAVHVWRLKDSKKHSNSVKARRSWGGKVKGLVANNERNHFLSQRAETLLQSLKHRFPGLPQTALDMAKIQYNKVHYLNL* |
ORF Type | complete |
Blastp | Rop guanine nucleotide exchange factor 1 from Arabidopsis with 77.81% of identity |
---|---|
Blastx | Rop guanine nucleotide exchange factor 1 from Arabidopsis with 77.31% of identity |
Eggnog | rop guanine nucleotide exchange factor(ENOG4110DIX) |
Kegg | Link to kegg annotations (AT4G38430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413138.1) |
Pfam | PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer