Protein coding transcript 223493

• Transcript: Ll_transcript_204456
• CDS coordinates: 348-1217 (+)
• Peptide sequence: MTECSDPENSNNMILEGRKDSLIRTCPTCGHHIKCQDQGSGVHDLPGLPAGVKFDPTDQEILEHLEAKVRSDIQKLHPLIDEFIPTLEGENGICCTHPEKLPGVNMDGLIRHFFHRPSKAYMTGTRKRRKVHTDADGSETRWHKTGKTRPIYINGKIKGYKKILVLYTNYKRERKPEKTNWVMHQYHLGNNEEEKEGELVVSKVFYQTQPRQCGLLMKGSFPAKVNGEGVHNVTNQIDNEFVEEYNTSIISFDQGDQHRLIKKQGDQHRPSNAEVVSHFPVHDDVSFIP*
• ORF Type: complete

Annotations of Ll_transcript_204456

• Blastp: NAC domain-containing protein 73 from Arabidopsis with 76.1% of identity
• Blastx: NAC domain-containing protein 73 from Arabidopsis with 76.73% of identity
• Eggnog: NAC domain-containing protein 8-like(ENOG410YF7Q)
• Kegg: Link to kegg annotations (AT4G28500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431327.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;