Protein coding transcript 223501

• Transcript: Ll_transcript_204452
• CDS coordinates: 998-1357 (+)
• Peptide sequence: MHQYHLGSNEEEKDGELVVSKVFYQTQPRQCGNNNSFIKDPYENKLNNQIGHDDDSTILPKNASPLNYYDAPYINYDHVVHDRESSPQLIPNMVAHQGDGSSFIRLAMDHANKARLERK*
• ORF Type: complete

Annotations of Ll_transcript_204452

• Blastp: NAC domain-containing protein 10 from Arabidopsis with 42.5% of identity
• Blastx: NAC domain-containing protein 10 from Arabidopsis with 60.5% of identity
• Eggnog: No apical meristem (NAM) protein(ENOG41108VG)
• Kegg: Link to kegg annotations (AT1G28470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424751.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;