Transcript | Ll_transcript_204610 |
---|---|
CDS coordinates | 1-534 (+) |
Peptide sequence | RKQERLGSLSRRLRFSSKSHSIQFNSIQIEGMLTSNDQQIMVSSFLEVAQGQTAETARQFLQATSWQLEEALQLFLIGSEAGAALPSSHTPPLESVDSLIDQPHSEPRKETTNGSSGQNDGEVRPPLPVIRETLYDGAMLYGYDFHFLISLLNFKTEAFYSNFLYSVLLSFFNYMLM* |
ORF Type | 5prime_partial |
Blastp | Plant UBX domain-containing protein 7 from Arabidopsis with 50.72% of identity |
---|---|
Blastx | Plant UBX domain-containing protein 7 from Arabidopsis with 50.72% of identity |
Eggnog | UBX domain protein(ENOG410XSZZ) |
Kegg | Link to kegg annotations (AT1G14570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420768.1) |
Pfam | UBA-like domain (PF14555.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer