Transcript | Ll_transcript_205722 |
---|---|
CDS coordinates | 521-1282 (+) |
Peptide sequence | MDYCLRELEGKQANDPLFIVKMNNKLSSSSSSSSPSSSPKSSCVFVPGPVIVGAGPSGLAAAACLKEKGVPSLILERSNCIASLWQHKTYDRLHLHLPKQFCELPLMGFPSDFPTYPTKQQFIGYLETYAEKFGIRPRFNETVKHAEFDSKVGFWHLKCVDKAEIVTEFVCKWLIVATGENAEAVVPNIEGVEEFGGSIKHTSLYKSGEEFRGKKVLVVGCGNSGMEVCLDLCNHDASPSLVVRDTVRNSILS* |
ORF Type | complete |
Blastp | Indole-3-pyruvate monooxygenase YUCCA6 from Arabidopsis with 62.4% of identity |
---|---|
Blastx | Indole-3-pyruvate monooxygenase YUCCA2 from Arabidopsis with 67.96% of identity |
Eggnog | Monooxygenase(COG2072) |
Kegg | Link to kegg annotations (AT5G25620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438397.1) |
Pfam | Pyridine nucleotide-disulphide oxidoreductase (PF13738.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer