Protein coding transcript 223587

• Transcript: Ll_transcript_205722
• CDS coordinates: 521-1282 (+)
• Peptide sequence: MDYCLRELEGKQANDPLFIVKMNNKLSSSSSSSSPSSSPKSSCVFVPGPVIVGAGPSGLAAAACLKEKGVPSLILERSNCIASLWQHKTYDRLHLHLPKQFCELPLMGFPSDFPTYPTKQQFIGYLETYAEKFGIRPRFNETVKHAEFDSKVGFWHLKCVDKAEIVTEFVCKWLIVATGENAEAVVPNIEGVEEFGGSIKHTSLYKSGEEFRGKKVLVVGCGNSGMEVCLDLCNHDASPSLVVRDTVRNSILS*
• ORF Type: complete

Annotations of Ll_transcript_205722

• Blastp: Indole-3-pyruvate monooxygenase YUCCA6 from Arabidopsis with 62.4% of identity
• Blastx: Indole-3-pyruvate monooxygenase YUCCA2 from Arabidopsis with 67.96% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT5G25620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438397.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF13738.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;