Protein coding transcript 2236

• Transcript: Ll_transcript_427168
• CDS coordinates: 727-1212 (+)
• Peptide sequence: MCGIEQYNGILMRYVKASSAYLGKQEDAIDFDITYYRSKDPMSPRLYEDIIEEIEQLGIFKYGGIPHWGKNRNLAFQGVINKYKSARKFLVVKKVYDPQGLFSSDWTDQILGLKEGVTILKDGCALEGLCICSQDSHCNPNKGYFCKPGKVYKEAKVCTHQ*
• ORF Type: complete

Annotations of Ll_transcript_427168

• Blastp: Probable L-gulonolactone oxidase 6 from Arabidopsis with 72.33% of identity
• Blastx: Probable L-gulonolactone oxidase 6 from Arabidopsis with 68.28% of identity
• Eggnog: FAD linked oxidase domain protein(COG0277)
• Kegg: Link to kegg annotations (AT2G46760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456397.1)
• Pfam: D-arabinono-1,4-lactone oxidase (PF04030.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;