Transcript | Ll_transcript_427168 |
---|---|
CDS coordinates | 727-1212 (+) |
Peptide sequence | MCGIEQYNGILMRYVKASSAYLGKQEDAIDFDITYYRSKDPMSPRLYEDIIEEIEQLGIFKYGGIPHWGKNRNLAFQGVINKYKSARKFLVVKKVYDPQGLFSSDWTDQILGLKEGVTILKDGCALEGLCICSQDSHCNPNKGYFCKPGKVYKEAKVCTHQ* |
ORF Type | complete |
Blastp | Probable L-gulonolactone oxidase 6 from Arabidopsis with 72.33% of identity |
---|---|
Blastx | Probable L-gulonolactone oxidase 6 from Arabidopsis with 68.28% of identity |
Eggnog | FAD linked oxidase domain protein(COG0277) |
Kegg | Link to kegg annotations (AT2G46760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456397.1) |
Pfam | D-arabinono-1,4-lactone oxidase (PF04030.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer