Protein coding transcript 223655

• Transcript: Ll_transcript_205253
• CDS coordinates: 3-398 (+)
• Peptide sequence: FNYYAIPYLAVLASVSGLQNTEAKLTHGELVLIACTILVGLFALQHYGTQKVAFVFAPIVIIWLVSIFSVGLYNTIYWNPKIVCAISPHYIIKFFIKTGKEGWISLGGILLCITGTEAMFADLGHFTALSIR
• ORF Type: internal

Annotations of Ll_transcript_205253

• Blastp: Potassium transporter 4 from Arabidopsis with 71.93% of identity
• Blastx: Potassium transporter 4 from Arabidopsis with 71.93% of identity
• Eggnog: Transport of potassium into the cell (By similarity)(COG3158)
• Kegg: Link to kegg annotations (AT3G02050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428335.1)
• Pfam: K+ potassium transporter (PF02705.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;