Protein coding transcript 223698

• Transcript: Ll_transcript_203254
• CDS coordinates: 1073-1690 (+)
• Peptide sequence: MEGMPGSYLLESPSNGNSSPKLPTSDTNEGYEIKEALRAQMEVQSKLHLQVEAEKHVQIWQDAEQRYMTMLERACKMLADQIISATVIGNDSRKFQGIGNKAPRGTMDDAIGFYSLPSSEVAGVHLPEEEIPPSLPPQRDDCSTSLTSHETPGGIGLEGTPRGGKRRMPGMESMAAPLIWSEAKIRTQAINVTQGNFHGMTRYDM*
• ORF Type: complete

Annotations of Ll_transcript_203254

• Blastp: Protein PHR1-LIKE 3 from Arabidopsis with 40% of identity
• Blastx: Protein PHR1-LIKE 2 from Arabidopsis with 71.26% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG410YGB1)
• Kegg: Link to kegg annotations (AT4G13640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440050.1)
• Pfam: MYB-CC type transfactor, LHEQLE motif (PF14379.5)
• Rfam: Intron_gpII (RF00029)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;