Transcript | Ll_transcript_204395 |
---|---|
CDS coordinates | 176-1117 (+) |
Peptide sequence | MADEAKAKGNAAFSSGDYAAAIRHFSDAIALSPTNHVLYSNRSAAYASIQSYTEALTDAKKTVELKPDWSKGYSRLGAAHIGLGQHSDAVSAYKKGLEIDPNNDALKSGLADAQSAAAAATRSRSAPPPSANPFGDAFSGPEMWAKLTADATTRVYLQQPDFVKMMQDIQKDPSNLNLYLKDQRVMRAIGVLLNIKIQTANDDSDIPEAEAEASSPSLSQSERKRAAEPEREPEPEPQPEPMDIPDEEKEAKEKKAQAQKEKEAGNAAYKKKDFDTAIQHYSKALELDDEDISFLTNRAAVYLEMGKVSFLYL* |
ORF Type | complete |
Blastp | Hsp70-Hsp90 organizing protein 1 from Soja with 65.81% of identity |
---|---|
Blastx | Hsp70-Hsp90 organizing protein 1 from Soja with 69.15% of identity |
Eggnog | tetratricopeptide repeat domain(ENOG410XTCJ) |
Kegg | Link to kegg annotations (547932) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445076.1) |
Pfam | Tetratricopeptide repeat (PF13432.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer