Protein coding transcript 223775

• Transcript: Ll_transcript_203596
• CDS coordinates: 1-855 (+)
• Peptide sequence: GYKVCIFAYGQTGSGKTYTMMGRPGHPEEKGLIPRSLEQIFQAKQSQQPQGWKYEMQVSMLEIYNETIRDLLSSNRLSSEATRLENGTPGKQYTIKHDASGNTHVSDLTVVDVNSIKEVGFLLNQAANSRSVGKTQMNEQSSRSHFVFTLRIYGVNESTDQQIQGILNLIDLAGSERLSKSGSTGDRLKETQAINKSLSSLSDVIFALAKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNISPDPTSAGESLCSLRFASRVNACEIGTPRRQTNWRSSDSRSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_203596

• Blastp: Kinesin-like protein KIN-14C from Arabidopsis with 82.46% of identity
• Blastx: Kinesin-like protein KIN-14C from Arabidopsis with 83.7% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT4G21270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464856.1)
• Pfam: Kinesin motor domain (PF00225.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;