Protein coding transcript 223783

• Transcript: Ll_transcript_203846
• CDS coordinates: 76-1149 (+)
• Peptide sequence: MIKVSASLLFCFMLGLLLHCEAHENKHNKIRFYELKRGNMHLNFTNYGATILSVRIPDKHGKIDDVVLGYDTINSYKNDTSYFGALIGRVANRIGGAKFILDGKTYKLPANDHGNTLHGGTRGFSDVLWNVKSHKKHSHVTFTYHSFDGEQGFPGKLDVSVTYMFIGKNKLGVRMIAKPVDKATPVNLAQHTYWNLRGHNSGDILSHTVQIFASQITPVDSNLIPTGRLQSIKGTPYDFLEPKEVGSRIHKLPGLYDINYVVDKSRKTHFNKVAIVKDPVSGRKMELWSNQVGVQYYTSGMLGDTKGKDGAVYHKYAGIALETQGFPDSVNHPNFPSQIVKPGEIYQHYMIYRFTAS*
• ORF Type: complete

Annotations of Ll_transcript_203846

• Blastp: Aldose 1-epimerase from Rattus with 41.09% of identity
• Blastx: Aldose 1-epimerase from Rattus with 41.46% of identity
• Eggnog: converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose (By similarity)(COG2017)
• Kegg: Link to kegg annotations (313843)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451266.1)
• Pfam: Aldose 1-epimerase (PF01263.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;