Transcript | Ll_transcript_203862 |
---|---|
CDS coordinates | 85-447 (+) |
Peptide sequence | MAGLAPEGSQFDARRYDANMNELSTSYANGQNMQIESYHGAPRPDDYNSYSTSHVQTQMGKDLKKGKSISRFLTKSWSIADPEITRKKRVAGYKMYYVEGKVKDCFRKSFRWLKNKCTSG* |
ORF Type | complete |
Blastp | Eukaryotic initiation factor 4A-7 from Nicotiana with 86.96% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | Link to kegg annotations (107783883) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437846.1) |
Pfam | Domain of unknown function (DUF3511) (PF12023.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer