Protein coding transcript 223977

• Transcript: Ll_transcript_205337
• CDS coordinates: 349-813 (+)
• Peptide sequence: MSPPLLVMEEEGQSKVSSLIIASTSSQSLDCFSQNGNDLKERNYIGLSDCSSVDSSSSTVPSFSHEKKENLNLKATELRLGLPGSQSPERNPDIYSSSLAKLDEKPLFPLLPMKDGIGLAYEKTVLWFQVTKEVLPMPWMGSLRGSLLGIPGWV*
• ORF Type: complete

Annotations of Ll_transcript_205337

• Blastp: Auxin-responsive protein IAA9 from Arabidopsis with 55.17% of identity
• Blastx: Auxin-responsive protein IAA8 from Arabidopsis with 61.94% of identity
• Eggnog: auxin-responsive protein(ENOG4111VTJ)
• Kegg: Link to kegg annotations (AT5G65670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422366.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;