Protein coding transcript 223979

• Transcript: Ll_transcript_205340
• CDS coordinates: 762-1310 (+)
• Peptide sequence: MDGFPQGKLIGNTGMGVMLSPTHTGAQSTAVREISSKVLHERPCAGNGASISGGAPASKAQVVGWPPIRSFRKNSMATTSKNNDEVDGKPGPTALFVKVSMDGAPYLRKVDLRNYTKYQELSLALEKMFSCFTLGQCGSHGAPGKEMLSESKLRDLLHGSEYVVTYEDKDGDWMLVGDVPWE*
• ORF Type: complete

Annotations of Ll_transcript_205340

• Blastp: Auxin-responsive protein IAA8 from Arabidopsis with 69.41% of identity
• Blastx: Auxin-responsive protein IAA8 from Arabidopsis with 67.01% of identity
• Eggnog: auxin-responsive protein(ENOG4111VTJ)
• Kegg: Link to kegg annotations (AT2G22670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422366.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;