Protein coding transcript 223984

• Transcript: Ll_transcript_205320
• CDS coordinates: 399-1226 (+)
• Peptide sequence: MSPPLLVTDEEGQSKVSSMVASASSQSLDCFSQNGVELKERNYMGLSDCSSVDSSSPIVPSFSDEKKGILNLKATELRLGLPGSQSPERNPDLYSLSSAKLDEKPLFPLLPMKDGICLSSQKTVVSGNKRGFADTMDGFPQGKFTGNTGMGVMLSPRSSGVQPRAVKEIPNKVLQERPCAANGASISSTAPVSKAQVVGWPPIRSFRKNSMATTSKNNNEVDGKPGPAALFVKVSMDGAPYLRKVDLRNYTTYQELSCALEKMFSCFTLGELLQF*
• ORF Type: complete

Annotations of Ll_transcript_205320

• Blastp: Auxin-responsive protein IAA9 from Arabidopsis with 57.2% of identity
• Blastx: Auxin-responsive protein IAA9 from Arabidopsis with 57.38% of identity
• Eggnog: auxin-responsive protein(ENOG4111VTJ)
• Kegg: Link to kegg annotations (AT5G65670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423994.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;