| Transcript | Ll_transcript_205475 |
|---|---|
| CDS coordinates | 1-327 (+) |
| Peptide sequence | TKLNFKDNRWSRHGMSALGTGGTRGIGHAIVEELAEFGATVHICARNQTDIDKCLEEWKDKGLSVTGSVCDVLYSHQRQSLMETVASIFPGKLNIIVNNAGLVIPKSIL |
| ORF Type | internal |
| Blastp | Tropinone reductase homolog from Datura with 65% of identity |
|---|---|
| Blastx | Tropinone reductase homolog from Datura with 65% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450253.1) |
| Pfam | short chain dehydrogenase (PF00106.24) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer