Protein coding transcript 224058

• Transcript: Ll_transcript_204971
• CDS coordinates: 2-316 (+)
• Peptide sequence: KAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALRKGKDGGGGGHDPFDVLGSFFDGGGSFGGGNSRGNWQRRREDAILGDEGHLSPWQF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_204971

• Blastp: Chaperone protein dnaJ 2 from Arabidopsis with 77.11% of identity
• Blastx: DnaJ protein homolog 1 from Allium with 87.5% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT5G22060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003521084.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;